PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000031172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 175aa    MW: 19590.6 Da    PI: 11.0012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000031172genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l  ++k +G g W++ +++ g++R++k+c++rw++yl
    MDP0000031172 14 RGAWTALEDKILTAYIKAHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.25.9e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
    MDP0000031172  67 RGNISGDEEELIVRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      6777889***************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.968961IPR017930Myb domain
SuperFamilySSF466898.17E-2812108IPR009057Homeodomain-like
SMARTSM007171.6E-121363IPR001005SANT/Myb domain
PfamPF002495.4E-141461IPR001005SANT/Myb domain
CDDcd001675.97E-91661No hitNo description
PROSITE profilePS5129422.69662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2365115IPR009057Homeodomain-like
SMARTSM007175.6E-1366114IPR001005SANT/Myb domain
PfamPF002498.5E-1467111IPR001005SANT/Myb domain
CDDcd001671.67E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAL EDKILTAYIK AHGEGKWRSL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SGDEEELIVR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLWKKSKADS  120
PSGSSKETSQ HPSKSVVKKK DVESKTTSTA AAKPLVIRTK ATRLSKILVP QNIPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251211225124MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.129840.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT6011230.0KT601123.1 Pyrus x bretschneideri cultivar Red Zaosu TT2-like transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008367629.11e-124PREDICTED: transcription repressor MYB6-like
SwissprotP102904e-65MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLQ0QMQ81e-112Q0QMQ8_MALDO; MYB9
STRINGVIT_04s0008g01800.t012e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.18e-63myb domain protein 7